published on Monday, May 4, 2026 by fortinetdev
published on Monday, May 4, 2026 by fortinetdev
Configure decrypted traffic mirror.
Example Usage
import * as pulumi from "@pulumi/pulumi";
import * as fortimanager from "@pulumi/fortimanager";
const trname = new fortimanager.ObjectFirewallDecryptedtrafficmirror("trname", {
dstmac: "ff:ff:ff:ff:ff:ff",
"interface": "any",
name: "terr-firewall-mirror",
trafficSource: "both",
trafficTypes: [
"ssh",
"ssl",
],
});
import pulumi
import pulumi_fortimanager as fortimanager
trname = fortimanager.ObjectFirewallDecryptedtrafficmirror("trname",
dstmac="ff:ff:ff:ff:ff:ff",
interface="any",
name="terr-firewall-mirror",
traffic_source="both",
traffic_types=[
"ssh",
"ssl",
])
package main
import (
"github.com/pulumi/pulumi-terraform-provider/sdks/go/fortimanager/fortimanager"
"github.com/pulumi/pulumi/sdk/v3/go/pulumi"
)
func main() {
pulumi.Run(func(ctx *pulumi.Context) error {
_, err := fortimanager.NewObjectFirewallDecryptedtrafficmirror(ctx, "trname", &fortimanager.ObjectFirewallDecryptedtrafficmirrorArgs{
Dstmac: pulumi.String("ff:ff:ff:ff:ff:ff"),
Interface: pulumi.String("any"),
Name: pulumi.String("terr-firewall-mirror"),
TrafficSource: pulumi.String("both"),
TrafficTypes: pulumi.StringArray{
pulumi.String("ssh"),
pulumi.String("ssl"),
},
})
if err != nil {
return err
}
return nil
})
}
using System.Collections.Generic;
using System.Linq;
using Pulumi;
using Fortimanager = Pulumi.Fortimanager;
return await Deployment.RunAsync(() =>
{
var trname = new Fortimanager.ObjectFirewallDecryptedtrafficmirror("trname", new()
{
Dstmac = "ff:ff:ff:ff:ff:ff",
Interface = "any",
Name = "terr-firewall-mirror",
TrafficSource = "both",
TrafficTypes = new[]
{
"ssh",
"ssl",
},
});
});
package generated_program;
import com.pulumi.Context;
import com.pulumi.Pulumi;
import com.pulumi.core.Output;
import com.pulumi.fortimanager.ObjectFirewallDecryptedtrafficmirror;
import com.pulumi.fortimanager.ObjectFirewallDecryptedtrafficmirrorArgs;
import java.util.List;
import java.util.ArrayList;
import java.util.Map;
import java.io.File;
import java.nio.file.Files;
import java.nio.file.Paths;
public class App {
public static void main(String[] args) {
Pulumi.run(App::stack);
}
public static void stack(Context ctx) {
var trname = new ObjectFirewallDecryptedtrafficmirror("trname", ObjectFirewallDecryptedtrafficmirrorArgs.builder()
.dstmac("ff:ff:ff:ff:ff:ff")
.interface_("any")
.name("terr-firewall-mirror")
.trafficSource("both")
.trafficTypes(
"ssh",
"ssl")
.build());
}
}
resources:
trname:
type: fortimanager:ObjectFirewallDecryptedtrafficmirror
properties:
dstmac: ff:ff:ff:ff:ff:ff
interface: any
name: terr-firewall-mirror
trafficSource: both
trafficTypes:
- ssh
- ssl
Example coming soon!
Create ObjectFirewallDecryptedtrafficmirror Resource
Resources are created with functions called constructors. To learn more about declaring and configuring resources, see Resources.
Constructor syntax
new ObjectFirewallDecryptedtrafficmirror(name: string, args?: ObjectFirewallDecryptedtrafficmirrorArgs, opts?: CustomResourceOptions);@overload
def ObjectFirewallDecryptedtrafficmirror(resource_name: str,
args: Optional[ObjectFirewallDecryptedtrafficmirrorArgs] = None,
opts: Optional[ResourceOptions] = None)
@overload
def ObjectFirewallDecryptedtrafficmirror(resource_name: str,
opts: Optional[ResourceOptions] = None,
adom: Optional[str] = None,
dstmac: Optional[str] = None,
interface: Optional[str] = None,
name: Optional[str] = None,
object_firewall_decryptedtrafficmirror_id: Optional[str] = None,
scopetype: Optional[str] = None,
traffic_source: Optional[str] = None,
traffic_types: Optional[Sequence[str]] = None,
update_if_exist: Optional[bool] = None)func NewObjectFirewallDecryptedtrafficmirror(ctx *Context, name string, args *ObjectFirewallDecryptedtrafficmirrorArgs, opts ...ResourceOption) (*ObjectFirewallDecryptedtrafficmirror, error)public ObjectFirewallDecryptedtrafficmirror(string name, ObjectFirewallDecryptedtrafficmirrorArgs? args = null, CustomResourceOptions? opts = null)
public ObjectFirewallDecryptedtrafficmirror(String name, ObjectFirewallDecryptedtrafficmirrorArgs args)
public ObjectFirewallDecryptedtrafficmirror(String name, ObjectFirewallDecryptedtrafficmirrorArgs args, CustomResourceOptions options)
type: fortimanager:ObjectFirewallDecryptedtrafficmirror
properties: # The arguments to resource properties.
options: # Bag of options to control resource's behavior.
resource "fortimanager_objectfirewalldecryptedtrafficmirror" "name" {
# resource properties
}Parameters
- name string
- The unique name of the resource.
- args ObjectFirewallDecryptedtrafficmirrorArgs
- The arguments to resource properties.
- opts CustomResourceOptions
- Bag of options to control resource's behavior.
- resource_name str
- The unique name of the resource.
- args ObjectFirewallDecryptedtrafficmirrorArgs
- The arguments to resource properties.
- opts ResourceOptions
- Bag of options to control resource's behavior.
- ctx Context
- Context object for the current deployment.
- name string
- The unique name of the resource.
- args ObjectFirewallDecryptedtrafficmirrorArgs
- The arguments to resource properties.
- opts ResourceOption
- Bag of options to control resource's behavior.
- name string
- The unique name of the resource.
- args ObjectFirewallDecryptedtrafficmirrorArgs
- The arguments to resource properties.
- opts CustomResourceOptions
- Bag of options to control resource's behavior.
- name String
- The unique name of the resource.
- args ObjectFirewallDecryptedtrafficmirrorArgs
- The arguments to resource properties.
- options CustomResourceOptions
- Bag of options to control resource's behavior.
Constructor example
The following reference example uses placeholder values for all input properties.
var objectFirewallDecryptedtrafficmirrorResource = new Fortimanager.ObjectFirewallDecryptedtrafficmirror("objectFirewallDecryptedtrafficmirrorResource", new()
{
Adom = "string",
Dstmac = "string",
Interface = "string",
Name = "string",
ObjectFirewallDecryptedtrafficmirrorId = "string",
Scopetype = "string",
TrafficSource = "string",
TrafficTypes = new[]
{
"string",
},
UpdateIfExist = false,
});
example, err := fortimanager.NewObjectFirewallDecryptedtrafficmirror(ctx, "objectFirewallDecryptedtrafficmirrorResource", &fortimanager.ObjectFirewallDecryptedtrafficmirrorArgs{
Adom: pulumi.String("string"),
Dstmac: pulumi.String("string"),
Interface: pulumi.String("string"),
Name: pulumi.String("string"),
ObjectFirewallDecryptedtrafficmirrorId: pulumi.String("string"),
Scopetype: pulumi.String("string"),
TrafficSource: pulumi.String("string"),
TrafficTypes: pulumi.StringArray{
pulumi.String("string"),
},
UpdateIfExist: pulumi.Bool(false),
})
resource "fortimanager_objectfirewalldecryptedtrafficmirror" "objectFirewallDecryptedtrafficmirrorResource" {
adom = "string"
dstmac = "string"
interface = "string"
name = "string"
object_firewall_decryptedtrafficmirror_id = "string"
scopetype = "string"
traffic_source = "string"
traffic_types = ["string"]
update_if_exist = false
}
var objectFirewallDecryptedtrafficmirrorResource = new ObjectFirewallDecryptedtrafficmirror("objectFirewallDecryptedtrafficmirrorResource", ObjectFirewallDecryptedtrafficmirrorArgs.builder()
.adom("string")
.dstmac("string")
.interface_("string")
.name("string")
.objectFirewallDecryptedtrafficmirrorId("string")
.scopetype("string")
.trafficSource("string")
.trafficTypes("string")
.updateIfExist(false)
.build());
object_firewall_decryptedtrafficmirror_resource = fortimanager.ObjectFirewallDecryptedtrafficmirror("objectFirewallDecryptedtrafficmirrorResource",
adom="string",
dstmac="string",
interface="string",
name="string",
object_firewall_decryptedtrafficmirror_id="string",
scopetype="string",
traffic_source="string",
traffic_types=["string"],
update_if_exist=False)
const objectFirewallDecryptedtrafficmirrorResource = new fortimanager.ObjectFirewallDecryptedtrafficmirror("objectFirewallDecryptedtrafficmirrorResource", {
adom: "string",
dstmac: "string",
"interface": "string",
name: "string",
objectFirewallDecryptedtrafficmirrorId: "string",
scopetype: "string",
trafficSource: "string",
trafficTypes: ["string"],
updateIfExist: false,
});
type: fortimanager:ObjectFirewallDecryptedtrafficmirror
properties:
adom: string
dstmac: string
interface: string
name: string
objectFirewallDecryptedtrafficmirrorId: string
scopetype: string
trafficSource: string
trafficTypes:
- string
updateIfExist: false
ObjectFirewallDecryptedtrafficmirror Resource Properties
To learn more about resource properties and how to use them, see Inputs and Outputs in the Architecture and Concepts docs.
Inputs
In Python, inputs that are objects can be passed either as argument classes or as dictionary literals.
The ObjectFirewallDecryptedtrafficmirror resource accepts the following input properties:
- Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Dstmac string
- Set destination MAC address for mirrored traffic.
- Interface string
- Decrypted traffic mirror interface
- Name string
- Name.
- Object
Firewall stringDecryptedtrafficmirror Id - an identifier for the resource with format {{name}}.
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Traffic
Source string - Source of decrypted traffic to be mirrored. Valid values:
client,server,both. - Traffic
Types List<string> - Types of decrypted traffic to be mirrored. Valid values:
ssl,ssh. - Update
If boolExist
- Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Dstmac string
- Set destination MAC address for mirrored traffic.
- Interface string
- Decrypted traffic mirror interface
- Name string
- Name.
- Object
Firewall stringDecryptedtrafficmirror Id - an identifier for the resource with format {{name}}.
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Traffic
Source string - Source of decrypted traffic to be mirrored. Valid values:
client,server,both. - Traffic
Types []string - Types of decrypted traffic to be mirrored. Valid values:
ssl,ssh. - Update
If boolExist
- adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - dstmac string
- Set destination MAC address for mirrored traffic.
- interface string
- Decrypted traffic mirror interface
- name string
- Name.
- object_
firewall_ stringdecryptedtrafficmirror_ id - an identifier for the resource with format {{name}}.
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - traffic_
source string - Source of decrypted traffic to be mirrored. Valid values:
client,server,both. - traffic_
types list(string) - Types of decrypted traffic to be mirrored. Valid values:
ssl,ssh. - update_
if_ boolexist
- adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - dstmac String
- Set destination MAC address for mirrored traffic.
- interface_ String
- Decrypted traffic mirror interface
- name String
- Name.
- object
Firewall StringDecryptedtrafficmirror Id - an identifier for the resource with format {{name}}.
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - traffic
Source String - Source of decrypted traffic to be mirrored. Valid values:
client,server,both. - traffic
Types List<String> - Types of decrypted traffic to be mirrored. Valid values:
ssl,ssh. - update
If BooleanExist
- adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - dstmac string
- Set destination MAC address for mirrored traffic.
- interface string
- Decrypted traffic mirror interface
- name string
- Name.
- object
Firewall stringDecryptedtrafficmirror Id - an identifier for the resource with format {{name}}.
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - traffic
Source string - Source of decrypted traffic to be mirrored. Valid values:
client,server,both. - traffic
Types string[] - Types of decrypted traffic to be mirrored. Valid values:
ssl,ssh. - update
If booleanExist
- adom str
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - dstmac str
- Set destination MAC address for mirrored traffic.
- interface str
- Decrypted traffic mirror interface
- name str
- Name.
- object_
firewall_ strdecryptedtrafficmirror_ id - an identifier for the resource with format {{name}}.
- scopetype str
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - traffic_
source str - Source of decrypted traffic to be mirrored. Valid values:
client,server,both. - traffic_
types Sequence[str] - Types of decrypted traffic to be mirrored. Valid values:
ssl,ssh. - update_
if_ boolexist
- adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - dstmac String
- Set destination MAC address for mirrored traffic.
- interface String
- Decrypted traffic mirror interface
- name String
- Name.
- object
Firewall StringDecryptedtrafficmirror Id - an identifier for the resource with format {{name}}.
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - traffic
Source String - Source of decrypted traffic to be mirrored. Valid values:
client,server,both. - traffic
Types List<String> - Types of decrypted traffic to be mirrored. Valid values:
ssl,ssh. - update
If BooleanExist
Outputs
All input properties are implicitly available as output properties. Additionally, the ObjectFirewallDecryptedtrafficmirror resource produces the following output properties:
- Id string
- The provider-assigned unique ID for this managed resource.
- Id string
- The provider-assigned unique ID for this managed resource.
- id string
- The provider-assigned unique ID for this managed resource.
- id String
- The provider-assigned unique ID for this managed resource.
- id string
- The provider-assigned unique ID for this managed resource.
- id str
- The provider-assigned unique ID for this managed resource.
- id String
- The provider-assigned unique ID for this managed resource.
Look up Existing ObjectFirewallDecryptedtrafficmirror Resource
Get an existing ObjectFirewallDecryptedtrafficmirror resource’s state with the given name, ID, and optional extra properties used to qualify the lookup.
public static get(name: string, id: Input<ID>, state?: ObjectFirewallDecryptedtrafficmirrorState, opts?: CustomResourceOptions): ObjectFirewallDecryptedtrafficmirror@staticmethod
def get(resource_name: str,
id: str,
opts: Optional[ResourceOptions] = None,
adom: Optional[str] = None,
dstmac: Optional[str] = None,
interface: Optional[str] = None,
name: Optional[str] = None,
object_firewall_decryptedtrafficmirror_id: Optional[str] = None,
scopetype: Optional[str] = None,
traffic_source: Optional[str] = None,
traffic_types: Optional[Sequence[str]] = None,
update_if_exist: Optional[bool] = None) -> ObjectFirewallDecryptedtrafficmirrorfunc GetObjectFirewallDecryptedtrafficmirror(ctx *Context, name string, id IDInput, state *ObjectFirewallDecryptedtrafficmirrorState, opts ...ResourceOption) (*ObjectFirewallDecryptedtrafficmirror, error)public static ObjectFirewallDecryptedtrafficmirror Get(string name, Input<string> id, ObjectFirewallDecryptedtrafficmirrorState? state, CustomResourceOptions? opts = null)public static ObjectFirewallDecryptedtrafficmirror get(String name, Output<String> id, ObjectFirewallDecryptedtrafficmirrorState state, CustomResourceOptions options)resources: _: type: fortimanager:ObjectFirewallDecryptedtrafficmirror get: id: ${id}import {
to = fortimanager_objectfirewalldecryptedtrafficmirror.example
id = "${id}"
}
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- resource_name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Dstmac string
- Set destination MAC address for mirrored traffic.
- Interface string
- Decrypted traffic mirror interface
- Name string
- Name.
- Object
Firewall stringDecryptedtrafficmirror Id - an identifier for the resource with format {{name}}.
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Traffic
Source string - Source of decrypted traffic to be mirrored. Valid values:
client,server,both. - Traffic
Types List<string> - Types of decrypted traffic to be mirrored. Valid values:
ssl,ssh. - Update
If boolExist
- Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Dstmac string
- Set destination MAC address for mirrored traffic.
- Interface string
- Decrypted traffic mirror interface
- Name string
- Name.
- Object
Firewall stringDecryptedtrafficmirror Id - an identifier for the resource with format {{name}}.
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Traffic
Source string - Source of decrypted traffic to be mirrored. Valid values:
client,server,both. - Traffic
Types []string - Types of decrypted traffic to be mirrored. Valid values:
ssl,ssh. - Update
If boolExist
- adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - dstmac string
- Set destination MAC address for mirrored traffic.
- interface string
- Decrypted traffic mirror interface
- name string
- Name.
- object_
firewall_ stringdecryptedtrafficmirror_ id - an identifier for the resource with format {{name}}.
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - traffic_
source string - Source of decrypted traffic to be mirrored. Valid values:
client,server,both. - traffic_
types list(string) - Types of decrypted traffic to be mirrored. Valid values:
ssl,ssh. - update_
if_ boolexist
- adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - dstmac String
- Set destination MAC address for mirrored traffic.
- interface_ String
- Decrypted traffic mirror interface
- name String
- Name.
- object
Firewall StringDecryptedtrafficmirror Id - an identifier for the resource with format {{name}}.
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - traffic
Source String - Source of decrypted traffic to be mirrored. Valid values:
client,server,both. - traffic
Types List<String> - Types of decrypted traffic to be mirrored. Valid values:
ssl,ssh. - update
If BooleanExist
- adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - dstmac string
- Set destination MAC address for mirrored traffic.
- interface string
- Decrypted traffic mirror interface
- name string
- Name.
- object
Firewall stringDecryptedtrafficmirror Id - an identifier for the resource with format {{name}}.
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - traffic
Source string - Source of decrypted traffic to be mirrored. Valid values:
client,server,both. - traffic
Types string[] - Types of decrypted traffic to be mirrored. Valid values:
ssl,ssh. - update
If booleanExist
- adom str
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - dstmac str
- Set destination MAC address for mirrored traffic.
- interface str
- Decrypted traffic mirror interface
- name str
- Name.
- object_
firewall_ strdecryptedtrafficmirror_ id - an identifier for the resource with format {{name}}.
- scopetype str
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - traffic_
source str - Source of decrypted traffic to be mirrored. Valid values:
client,server,both. - traffic_
types Sequence[str] - Types of decrypted traffic to be mirrored. Valid values:
ssl,ssh. - update_
if_ boolexist
- adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - dstmac String
- Set destination MAC address for mirrored traffic.
- interface String
- Decrypted traffic mirror interface
- name String
- Name.
- object
Firewall StringDecryptedtrafficmirror Id - an identifier for the resource with format {{name}}.
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - traffic
Source String - Source of decrypted traffic to be mirrored. Valid values:
client,server,both. - traffic
Types List<String> - Types of decrypted traffic to be mirrored. Valid values:
ssl,ssh. - update
If BooleanExist
Import
ObjectFirewall DecryptedTrafficMirror can be imported using any of these accepted formats:
$ export “FORTIMANAGER_IMPORT_TABLE”=“true”
$ pulumi import fortimanager:index/objectFirewallDecryptedtrafficmirror:ObjectFirewallDecryptedtrafficmirror labelname {{name}}
$ unset “FORTIMANAGER_IMPORT_TABLE”
-> Hint: The scopetype and adom for import will directly inherit the scopetype and adom configuration of the provider.
To learn more about importing existing cloud resources, see Importing resources.
Package Details
- Repository
- fortimanager fortinetdev/terraform-provider-fortimanager
- License
- Notes
- This Pulumi package is based on the
fortimanagerTerraform Provider.
published on Monday, May 4, 2026 by fortinetdev